A practical reference on peptide research: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2026-04-12. Anything still debated is marked as such rather than presented as settled.
In the scientific literature, AOD-9604 appears in reviews of growth hormone fragments and in discussions of peptide-based metabolic research. Some sources distinguish it from growth hormone itself, while others group it with compounds marketed for weight management. The evidence base is small compared with approved obesity medications. Questions about long-term efficacy and clinical relevance remain open, and independent replication of key findings is limited. Most published reports are early-stage and exploratory.
AOD-9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It is often described as hGH fragment 176-191. Research interest arose because it was designed to isolate possible effects on fat metabolism from other actions of growth hormone. It is not a full growth hormone molecule. Its development history includes early laboratory and animal studies followed by human trials. The peptide has been examined in laboratory, animal, and limited human studies.
Quality varies among research-grade suppliers, so certificates of analysis and independent testing are important for verification. A typical certificate reports purity by HPLC, identity by mass spectrometry, appearance, and sometimes residual solvents or water content. AOD9604 is often sold as a research chemical not intended for human consumption, and labels can be inaccurate. Common misconceptions include treating the peptide as a form of growth hormone, assuming supplement status, or expecting approved-drug quality from unregulated products.
AOD9604 is commonly supplied as a white to off-white lyophilized powder. The powder is typically stored at -20 °C or below, protected from light and moisture, because peptides can degrade through oxidation, hydrolysis, or aggregation. If it is reconstituted for laboratory use, an appropriate aqueous buffer or solvent is chosen, and the solution is kept cold and handled to avoid repeated freeze-thaw cycles. These practices support stability but do not imply suitability for human use.
| Property | Value | Notes |
|---|---|---|
| Common synonym | hGH fragment 176-191 | Refers to the C-terminal segment |
| Appearance | White to off-white powder | Typically supplied lyophilized |
| Solubility | Soluble in water and aqueous buffers | Confirm with technical data |
| Typical storage temperature | -20 °C for dry powder | Protect from moisture and light |
| Common analytical method | RP-HPLC with UV detection | Often paired with mass spectrometry |
In laboratory settings, AOD-9604 is commonly supplied as a lyophilized powder and stored cold to limit degradation. Reconstituted solutions are typically kept refrigerated or frozen, depending on the buffer and concentration, and protected from repeated freeze-thaw cycles. Stability can be influenced by pH, temperature, and the presence of proteases. Purity is usually assessed by high-performance liquid chromatography and mass spectrometry. These practices support reproducibility, but they do not imply safety or efficacy for any human use.
Regulatory status: AOD-9604 is not approved as a therapeutic drug in the United States, European Union, or other major markets. It is listed by the World Anti-Doping Agency as a prohibited substance in sport, specifically under growth hormone fragments. Many jurisdictions restrict its sale for human consumption. Products marketed online may not meet pharmaceutical quality standards. The legal status varies by country and often depends on whether the material is presented as a research chemical, supplement, or drug.
Detection and characterization of AOD-9604 in research and anti-doping settings typically rely on mass spectrometry coupled with liquid chromatography. These methods can identify the peptide by its mass and fragmentation pattern. Immunoassays may also be used in some screening contexts, but they can cross-react with related peptides. Because the molecule is small and may be present at low concentrations, sample preparation and method validation are important. Confirmatory analysis usually requires comparison with a certified reference standard.
Detection of AOD-9604 in biological samples relies on analytical techniques capable of distinguishing a small synthetic peptide from related endogenous sequences. Liquid chromatography coupled with tandem mass spectrometry is commonly used for confirmatory analysis. Sample preparation may involve immunoaffinity enrichment or solid-phase extraction to concentrate the peptide. Because the molecule is small and may be present at low concentrations, assay sensitivity and specificity are ongoing analytical challenges. Laboratories also validate methods against reference materials when available.
Regulatory interest in AOD-9604 increased after high-profile anti-doping cases involving peptide products. In some cases, the substance was supplied under alternative names or in compounded preparations, complicating traceability. Sports tribunals and anti-doping panels have discussed whether the peptide was explicitly banned at the time of use, leading to clarifications by the World Anti-Doping Agency. For consumers and researchers, the legal status can vary by jurisdiction, and products marketed as research chemicals may lack independent quality verification.
AOD-9604 is listed as a prohibited substance in sport by the World Anti-Doping Agency. It falls under the peptide hormones, growth factors, related substances, and mimetics class on the prohibited list. Anti-doping organizations treat its presence in an athlete's sample as an adverse finding unless a therapeutic use exemption applies. The prohibition reflects concerns about performance enhancement in competitive settings and the difficulty of distinguishing exogenous peptide use from endogenous hormone fragments.
AOD-9604 is prohibited in sport by the World Anti-Doping Agency under the peptide hormone class. Its presence in a sample can be detected through mass spectrometry-based methods, although the exact assay depends on the laboratory. In research settings, material is often supplied as a lyophilized powder for reconstitution. Buyers and researchers should note that products labeled AOD-9604 may vary in purity and actual peptide content. Analytical certificates and independent testing are common ways to verify identity, but no global harmonized standard exists for all commercial lots.
AOD-9604 is a synthetic peptide whose sequence is modeled on the C-terminal region of human growth hormone. Published descriptions commonly place it as a modified fragment corresponding to hGH amino acids 176–191, with a tyrosine residue added or retained at the N-terminus to support detection and handling. It is not intact growth hormone and lacks the full receptor-binding architecture of the parent protein. The molecule was developed as a research candidate for metabolic studies rather than as a replacement for growth hormone therapy. Its identity is defined by its amino acid sequence rather than by any single commercial preparation.
Research interest in AOD-9604 often focuses on whether it can influence lipid metabolism without the growth-promoting or glucose-related effects of full-length hGH. This question remains unresolved, and findings depend on model, dose, and measurement method. Some reviews treat the peptide as a historical obesity candidate rather than an active therapeutic. Others cite it in discussions of peptide fragments, metabolic signaling, and performance-enhancing substances. Clear conclusions are limited by the small number of rigorous, independent human studies.
AOD-9604 has been investigated primarily as a potential treatment for obesity and related metabolic conditions. Early laboratory work examined its effects on fat cells, and later studies moved into animal models and human clinical trials. Some trials reportedly reached Phase II, but the program did not lead to an approved medicine. Published summaries often note that weight-loss results were modest or inconsistent. The full trial data are not all publicly available in detail.
Overall, automated synthesis has improved the efficiency for the parallel synthesis and combinatorial methods of polymers. These techniques aim to design new materials, in addition to studying the relationships of their structure and properties. However, while screening for polymers enables this investigation, it becomes increasingly demanding for researchers to create the libraries for these synthetic compositions. In addition, preparation requires a large number of repetitive reactions to be completed, leading to an immense burden of planning and labor. Using automated synthesis, this process can be refined, increasing the efficiency of the reaction and removing the impact of human error.
Clostridioides difficile has a highly diverse epigenome, with 17 high-quality methylation motifs reported so far, the majority pertaining to the 6mA type. Methylation at one of these motifs - CAAAAA, was shown to impact sporulation, a key step in C. difficile disease transmission, as well as cell length, biofilm formation, and host colonization. At least eight mainly temperate bacteriophages have been isolated from C. difficile, ranging in genome size from about 30 to about 60 kbp. Both environmentally and clinically derived C. difficile strains carry a diverse and prevalent set of prophages. Canada Pathogen Safety Data Sheets: Infectious Substances – Clostridium difficile, Public Health Agency, Canada, September 10, 2014. Type strain of Clostridium difficile, BacDive—the Bacterial Diversity Metadatabase
The Swiss company GlycArt Biotechnology developed a system using CHO cells, where the cells were engineered to overexpress an enzyme called GnTIII. The effect of this overexpression is to block the formation of fucosylated oligosaccharides on the expressed antibodies. This technology was first reported in 1999 and was the basis of GlycArt Biotechnology. Roche acquired GlycArt in 2005 in order to acquire technology to afucosylate antibodies. GlycArt Biotechnology had been founded in 2000 as a spin-out company of the Swiss Federal Institute of Technology in Zurich. The first commercial product from the GlycArt acquisition was obinutuzumab, which as Gazyva gained FDA approval in November 2013 for the treatment of chronic lymphocytic leukemia. Kyowa Hakko Kirin's "Potelligent" platform uses a CHO cell line in which FUT8 has been knocked out, and which produces antibodies with little to no fucose in the Fc region. The company gained marketing approval in Japan in April 2012 for a monoclonal antibody drug called mogamulizumab which was developed using the platform. The Company's technology was first reported in 2004.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Acromegaly is a disorder that results in excess growth of certain parts of the human body. It is caused by excess growth hormone (GH) after the growth plates have closed. The initial symptom is typically enlargement of the hands and feet. There may also be an enlargement of the forehead, jaw, and nose. Other symptoms may include joint pain, thickened skin, deepening of the voice, headaches, and problems with vision. Complications of the disease may include type 2 diabetes, sleep apnea, and high blood pressure. Features that may result from a high level of GH or expanding tumor include:
Sources: en.wikipedia.org
The permeability of a membrane is the rate of passive diffusion of molecules through the membrane. These molecules are known as permeant molecules. Permeability depends mainly on the electric charge and polarity of the molecule and to a lesser extent the molar mass of the molecule. Due to the cell membrane's hydrophobic nature, small electrically neutral molecules pass through the membrane more easily than charged, large ones. The inability of charged molecules to pass through the cell membrane results in pH partition of substances throughout the fluid compartments of the body. Lipids, Membranes and Vesicle Trafficking – The Virtual Library of Biochemistry and Cell Biology Cell membrane protein extraction protocol Membrane homeostasis, tension regulation, mechanosensitive membrane exchange and membrane traffic 3D structures of proteins associated with plasma membrane of eukaryotic cells Lipid composition and proteins of some eukariotic membranes Prokaryotic and Eukaryotic Cells
The AToFMS allows for the determination of mixing state, or distribution of chemical species, within individual particles. These mixing states are important in the determination of climate and health impact of aerosols. The schematic of a typical AToFMS is shown to the right. The overall structure of ATOF instruments is; sampling, sizing, and the mass analyzer region. The inlet system is similar to the AMS by using the same aerodynamic focusing lens, but it has smaller orifices because of its analysis of single particles. In the sizing region particle passes through the first continuous solid state laser that generates an initial pulse of scattered light. Then the particle passes through the second laser that is orthogonal to the first and produces a pulse of scattered light. The light is detected by a photomultiplier (PMT) that is matched up to each laser. Using the transit times between the two detected pulses and the fixed distance the velocity and size of each particle is calculated. Next the particles travel through to the mass analyzer region where it is ionized by a pulsed LDI laser, which is timed to hit the particle as it reaches the center of the ion extraction region. Once ionized, the positive ions are accelerated towards the positive ToF section and the negative ions are accelerated towards the negative ToF section where they are detected.
The tumor-suppressor protein p53 accumulates when DNA is damaged due to a chain of biochemical factors. Part of this pathway includes alpha-interferon and beta-interferon, which induce transcription of the p53 gene, resulting in the increase of p53 protein level and enhancement of cancer cell-apoptosis. p53 prevents the cell from replicating by stopping the cell cycle at G1, or interphase, to give the cell time to repair; however, it will induce apoptosis if damage is extensive and repair efforts fail. Any disruption to the regulation of the p53 or interferon genes will result in impaired apoptosis and the possible formation of tumors.
In humans, FDC-SP was first found within follicular dendritic cell isolates from the tonsil, and later was found to be specifically expressed within the periodontal ligament. FDC-SP expression can be induced in human FDC-like cell lines by exposure to tumour necrosis factor (TNF). Exposure of human peripheral blood cells to LPS can also result in FDC-SP expression, but TNF exposure does not cause FDC-SP expression and similarly LPS exposure does not cause expression within FDC-like cell lines. Expression in mouse splenocytes can be induced by LPS in a similar manner to that of human peripheral blood cells. In mice, as in humans, FDC-SP is not expressed in B cells, but FDC-SP expression in FDCs can be dependent on B cells after their stimulation by CD40. After stimulation with CD40, B cells have been shown to be able to induce phenotypic changes in FDCs through the B cell's surface TNF expression. It has therefore been suggested that the expression of TNF cytokines by B cells causes FDC-SP expression within FDCs upon contact. This reaction is said to be typical during GC formation. FDC-SP is highly expressed in the junctional epithelium and well as in the tonsils, prostate, lymph nodes and trachea. The proline rich region in the C-terminal half bears some resemblance to the antimicrobial peptide Bac5. FDC-SP may therefore have a role in microbial defense in the oral cavity.
Ana María Muñoz Jauregui (born 1969, Lima) is a Peruvian pharmacist, biochemist and nutritionist. She has served as Rector and, since 2023, as the Vice Rector of research at San Ignacio de Loyola University (USIL). Muñoz has authored numerous publications and received national and international awards, such as silver, gold medals and semi-grand prize wins at the International KIWIE Award. Muñoz, was born in Lima, Peru. In 1996, she attended the National University of San Marcos (UNMSM), where she earned her pharmaceutical degree. While studying, she developed an interest in the field of nutrition. She earned a master's degree in biochemistry and nutrition, and earned a PhD in Pharmacy and Biochemistry from the National University of San Marcos (UNMSM) in 2006.
Sources: en.wikipedia.org
The AAA proteins contain two domains, an N-terminal alpha/beta domain that binds and hydrolyzes nucleotides (a Rossmann fold) and a C-terminal alpha-helical domain. The N-terminal domain is 200-250 amino acids long and contains Walker A and Walker B motifs, and is shared in common with other P-loop NTPases, the superfamily which includes the AAA family. Most AAA proteins have additional domains that are used for oligomerization, substrate binding and/or regulation. These domains can lie N- or C-terminal to the AAA module. Some classes of AAA proteins have an N-terminal non-ATPase domain which is followed by either one or two AAA domains (D1 and D2). In some proteins with two AAA domains, both are evolutionarily well conserved (like in Cdc48/p97). In others, either the D2 domain (like in Pex1p and Pex6p) or the D1 domain (in Sec18p/NSF) is better conserved in evolution. While the classical AAA family was based on motifs, the family has been expanded using structural information and is now termed the AAA family.
Chattopadhyay's contributions in membrane and receptor biology and biophysics have been recognized by several awards and prizes. These include The World Academy of Sciences (TWAS) Prize, Shanti Swarup Bhatnagar Award, Ranbaxy Research Award, Prof. G.N. Ramachandran Gold Medal, SERB Distinguished Fellowship, Prof. G.N. Ramachandran 60th Birthday Medal and J.C. Bose Fellowship. He is an elected Fellow of The World Academy of Sciences, Royal Society of Biology, Royal Society of Chemistry, and all the Indian Academies of Science. Fellow, The World Academy of Sciences (2017) Fellow, The Royal Society of Biology (2017) Fellow, The Royal Society of Chemistry (2013) Fellow, Indian National Science Academy (2005) Fellow, Indian Academy of Sciences (1999) Fellow, The National Academy of Sciences, India (1998) Fellow, West Bengal Academy of Science & Technology (2010) Fellow, Andhra Pradesh Akademi of Sciences (2003) Fellow, Telangana Academy of Sciences (2015) Google Scholar
Some mutations of SNX8 have been related to certain types of cancer, specially to stomach and endometrial cancer. The bar plot on the right shows the proportion of tumor samples from 15 cancer types that have any kind of altering mutations in the given protein. Moreover, some studies seem to draw an important relationship between different type of cancers and SNX8 expression; although most of the patients with colorectal, stomach or testis cancer showed high levels of SNX8, almost any patient with prostate, endometrial or carcinoid cancer presented low or any concentrations of SNX8. The rationale behind this differential phenotype of SNX8 synthesis remains unclear.
The centrifugal partition chromatograph instrument is constituted with a unique rotor which contains the column. This rotor rotates on its central axis (while HSCCC column rotates on its planetary axis and simultaneously rotates eccentrically about another solar axis). With less vibrations and noise, the CPC offers a typical rotation speed range from 500 to 2000 rpm. Contrary to hydrodynamic CCC, the rotation speed is not directly proportional to the retention volume ratio of the stationary phase. Like DCCC, CPC can be operated in either descending or ascending mode, where the direction is relative to the force generated by the rotor rather than gravity. A redesigned CPC column with larger chambers and channels has been named centrifugal partition extraction (CPE). In the CPE design, faster flow rates and increased column loading can be achieved.
Sources: en.wikipedia.org
It is a synthetic peptide fragment derived from the C-terminal region of human growth hormone, commonly referred to as hGH fragment 176-191. It has been investigated for effects on fat metabolism, but it is not an approved medication in most jurisdictions.
No. It is a shortened peptide fragment, not the full hormone. It does not contain the entire hGH sequence and is studied for different proposed effects.
Regulatory approvals for weight loss are not established in major jurisdictions. Some human trials reported modest changes, but the evidence is limited, and it remains a research compound.
Lyophilized AOD9604 is generally kept at -20 °C or colder, desiccated, and protected from light. Reconstituted solutions are usually refrigerated and handled to minimize repeated freeze-thaw cycles. These are general laboratory handling practices, not instructions for human use.